Zu "GeneID 7114" wurden 15 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Human Tb4 (Thymosin Beta 4) ELISA Kit
Artikelnummer: ELK-ELK4391.48
This assay employs the competitive inhibition enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with Human Tb4 protein. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human Tb4. Next, Avidin...
| Schlagworte: | TB4X, TMSB4X |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 365,00 €
Human Thymosin Beta 4 / TMSB4 ELISA Kit
Artikelnummer: G-HUFI02904.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
641,00 €
Anti-TMSB4X
Artikelnummer: G-CAB5438.100
| Anwendung: | IF, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 352,00 €
Anti-TYB4
Artikelnummer: ELK-ES19005.100
Protein function: Plays an important role in the organization of the cytoskeleton (PubMed:1999398, PubMed:10848969). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (PubMed:1999398, PubMed:10848969). [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular...
| Schlagworte: | Anti-TB4X, Anti-TMSB4X, TYB4 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 169,00 €
Anti-Thymosin b4 (TMSB4X, Thymosin beta-4, T beta-4, Fx,...
Artikelnummer: T5225-05H.100
Thymosin beta 4 is a 5kD member of the B-thymosin family of molecules. Members of this family range from 41-44aa in length, and possess an isoelectric point that lies between pH 4.0-7.0 a-thymosins have values less than 4.0. Multiple cell types produce TB4, either constitutively, or after stimulation. They include...
| Schlagworte: | Anti-TB4X, Anti-TMSB4X |
| Anwendung: | ICC, WB |
| Wirt: | Sheep |
| Spezies-Reaktivität: | human |
962,00 €
Thymosin Beta 4 (Tb4) BioAssay(TM) ELISA Kit (Human)
Artikelnummer: 028385.96
Thymosin beta 4 (Tbeta4) BioAssayT ELISA Kit is a competitive inhibition immunoassay for in vitro quantitative measurement of Tbeta4 in human serum, plasma and other biological fluids. Detection Range: 2.47-200ng/ml, Sensitivity: 0.91ng/ml, Intra-Assay CV: <10% , Inter-Assay CV: <12%, Kit Components: *028385A:...
| Schlagworte: | TB4X, TMSB4X |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
970,00 €
Thymosin B4 Sulfoxide, Human (T beta-4, Fx, TMSB4X, TB4X,...
Artikelnummer: 298288.1
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Synthetic human Thymosin B4 Sulfoxide , AA Sequence: SDKPD-M(O)-AEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, Storage and Stability:...
| Schlagworte: | TB4X, TMSB4X |
| Ursprungsart: | human |
| MW: | 4.8 kD |
ab 346,00 €
Thymosin B4 Sulfoxide, Human, CT (T beta-4, Fx, TMSB4X,...
Artikelnummer: 298289.100
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Synthetic human Thymosin B4 Sulfoxide, at C-terminal, AA Sequence: SDKPD-M(O)-AEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-L-Biotin,...
| Schlagworte: | TB4X, TMSB4X |
| Ursprungsart: | human |
| MW: | 5.2 kD |
797,00 €
Thymosin B4 Sulfoxide, Human, NT (T beta-4, Fx, TMSB4X,...
Artikelnummer: 298290.100
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Synthetic human Thymosin B4 Sulfoxide, at N-terminal, AA Sequence: Biotin-SDKPD-M(O)-AEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, Storage...
| Schlagworte: | TB4X, TMSB4X |
| Ursprungsart: | human |
| MW: | 5.1 kD |
762,00 €
Thymosin B4, Human, aa1-43 (T beta-4, Fx, TMSB4X)
Artikelnummer: 298294.100
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Synthetic human Thymosin B4, AA Sequence: AcSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, Storage and Stability: Lyophilized powder may...
| Schlagworte: | TB4X, TMSB4X |
| Ursprungsart: | human |
| MW: | 4.96 kD |
531,00 €
Thymosin B4, Human, CT (T beta-4, Fx, TMSB4X, TB4X,...
Artikelnummer: 298296.100
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Synthetic human Thymosin B4, at C-terminal, AA Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-L-Biotin. Underlined amino acids...
| Schlagworte: | TB4X, TMSB4X |
| Ursprungsart: | human |
| MW: | 5.2 kD |
655,00 €
Thymosin B4, Human, NT (T beta-4, Fx, TMSB4X, TB4X,...
Artikelnummer: 298297.100
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Synthetic human Thymosin B4, at N-terminal, AA Sequence: Biotin-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, Storage and Stability:...
| Schlagworte: | TB4X, TMSB4X |
| Ursprungsart: | human |
| MW: | 5.1 kD |
477,00 €